PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim08g005260.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 362aa    MW: 40648 Da    PI: 7.8518
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim08g005260.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.2e-32177230255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Sopim08g005260.0.1 177 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 230
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15174230IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28175230IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-24177230IPR006447Myb domain, plants
PfamPF002496.1E-7178229IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MELFPPQPDL SLQISPPNTT TNQEENNIDL SFWERALESR KPHNININNT CCFDLSLSSN  60
IPRPSSILNH QDPKYPSSQY FQNNTNFINN PFIPHHHHNL GLFSPISGVP LYNNHQNSST  120
NNTLPIQSSP TSFNNYNNIN PISSSNSHFH QSHNHQNGLM RSRFFSRFPT KRSMRAPRMR  180
WTSTLHARFV HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKTTDKSAVG  240
AASSGQSEVF DNVSSGDNSD DLLLEIKNSN KSELSVQQGR QNMYNQEKDY GGLWSNSSRE  300
SWHMHGKLGD YPGNLPSLEK NMEAKCTSYE GISTEVSSSS ITQASPKKPN LEFTLGIPNI  360
S*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0109390.0AP010939.1 Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0175O15, complete sequence.
GenBankHG9755200.0HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244407.20.0PREDICTED: probable transcription factor KAN2 isoform X2
SwissprotQ9C6162e-70KAN2_ARATH; Probable transcription factor KAN2
TrEMBLK4CI170.0K4CI17_SOLLC; Uncharacterized protein
STRINGSolyc08g005260.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27382255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.12e-68G2-like family protein